PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00593.30
Common NameJCGZ_26434, LOC105648782
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 186aa    MW: 21685.9 Da    PI: 10.0598
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00593.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.77.3e-29959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien +nrqvtfskRrng+lKKA+ELS+LCdaev++++fs++gk y ++s
  Jcr4S00593.30  9 KRIENPTNRQVTFSKRRNGLLKKAFELSILCDAEVCLLVFSPSGKAYQFAS 59
                   79**********************************************986 PP

2K-box62.22e-2179164792
          K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                    +++ ++  e++++e++ Lk+ ++  ++++Rh+ Ged+++L ++eL+qLe+qL +++++iRsk ++ l e+  +lqk+ k ++ +  
  Jcr4S00593.30  79 NDQRSRSLEYWRNEIEELKRTMDATETKIRHFCGEDISKLGMRELKQLERQLRTAIERIRSKMHKALQEENARLQKRVKIHELNDP 164
                    44677889*********************************************************************998776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.057161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.89E-33277IPR002100Transcription factor, MADS-box
CDDcd002653.08E-39270No hitNo description
PRINTSPR004043.0E-30323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.4E-1783159IPR002487Transcription factor, K-box
PROSITE profilePS5129710.95386179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010094Biological Processspecification of carpel identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGRGKVELKR IENPTNRQVT FSKRRNGLLK KAFELSILCD AEVCLLVFSP SGKAYQFASH  60
DMDRTIARYR SEVGLLGSND QRSRSLEYWR NEIEELKRTM DATETKIRHF CGEDISKLGM  120
RELKQLERQL RTAIERIRSK MHKALQEENA RLQKRVKIHE LNDPNVRYSI LEADALCRVL  180
HDGAVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-22271170Myocyte-specific enhancer factor 2A
3mu6_C1e-22271170Myocyte-specific enhancer factor 2A
3mu6_B1e-22271170Myocyte-specific enhancer factor 2A
3mu6_A1e-22271170Myocyte-specific enhancer factor 2A
1tqe_S2e-22169169Myocyte-specific enhancer factor 2B
1tqe_R2e-22169169Myocyte-specific enhancer factor 2B
1tqe_Q2e-22169169Myocyte-specific enhancer factor 2B
1tqe_P2e-22169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090674.11e-132PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1
TrEMBLA0A067JIE71e-129A0A067JIE7_JATCU; Uncharacterized protein
STRINGVIT_17s0000g01230.t014e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.21e-46MIKC_MADS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]